TUBB anticorps (N-Term)

N° du produit ABIN634598

L’anticorps Lapin Polyclonal anti-TUBB a été validé pour WB. Il convient pour détecter TUBB dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TUBB anticorps (N-Term) (ABIN634598)

Antigène: TUBB (Tubulin, beta (TUBB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TUBB anticorps

Épitope: N-Term

Specificité: Beta Tubulin antibody was raised against the N terminal of TUBB

Purification: Affinity purified

Immunogène: Beta Tubulin antibody was raised using the N terminal of TUBB corresponding to a region with amino acids YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Beta Tubulin Blocking Peptide, (ABIN936086), is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBB

Antigène: TUBB (Tubulin, beta (TUBB))

Autre désignation: beta Tubulin

Sujet: TUBB belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Dynamique des Microtubules, M Phase